PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 164aa    MW: 18739.1 Da    PI: 8.6327
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638896.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT eEd++lv +++++G g+W+  +r+ g+ R++k+c++rw++yl
   XP_013638896.1 14 RGGWTDEEDQKLVAYINEYGIGDWRFLPRKAGLQRCGKSCRLRWLNYL 61
                     789*******************************************97 PP

2Myb_DNA-binding56.56.5e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g++T+eE+e +++    lG++ W++Ia+ m+ gR+++++k++w++ 
   XP_013638896.1  67 KGKFTPEEEEAIINFQSILGNR-WAAIAQQMP-GRSDNDIKNHWNSC 111
                      79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.546961IPR017930Myb domain
SuperFamilySSF466892.24E-3012108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002494.6E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231668IPR009057Homeodomain-like
CDDcd001674.19E-111761No hitNo description
PROSITE profilePS5129425.87362116IPR017930Myb domain
SMARTSM007178.1E-1666114IPR001005SANT/Myb domain
PfamPF002495.1E-1667111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2569116IPR009057Homeodomain-like
CDDcd001672.23E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MGRATWFDAD GTKRGGWTDE EDQKLVAYIN EYGIGDWRFL PRKAGLQRCG KSCRLRWLNY  60
LRPGVKKGKF TPEEEEAIIN FQSILGNRWA AIAQQMPGRS DNDIKNHWNS CLKKRLERNG  120
IDQMTHQPII NLAVKIPSFN IDCGNSSSST DQEHLVGSEN ANHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638896.11e-122PREDICTED: transcription factor MYB32-like isoform X2
SwissprotO643994e-55MYB34_ARATH; Transcription factor MYB34
SwissprotQ7XQN16e-55MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0D3CBB71e-110A0A0D3CBB7_BRAOL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10016924e-88(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.12e-77myb domain protein 47